MAGT1 anticorps (N-Term)

N° du produit ABIN636081

Cet anticorps anti-MAGT1 est un anticorps Lapin Polyclonal détectant MAGT1 dans WB. Adapté pour Humain.

Aperçu rapide pour MAGT1 anticorps (N-Term) (ABIN636081)

Antigène: MAGT1 (Magnesium Transporter 1 (MAGT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAGT1 anticorps

Épitope: N-Term

Specificité: RP11-217 H1.1 antibody was raised against the N terminal Of Rp11-217 1.1

Purification: Affinity purified

Immunogène: RP11-217 H1.1 antibody was raised using the N terminal Of Rp11-217 1.1 corresponding to a region with amino acids ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RP.1 Blocking Peptide, (ABIN936886), is also available for use as a blocking control in assays to test for specificity of this RP.1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-210 1.1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGT1

Antigène: MAGT1 (Magnesium Transporter 1 (MAGT1))

Autre désignation: RP11-217H1.1

Sujet: The function of RP11-217H1.1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis