IL13RA2 anticorps (Middle Region)

N° du produit ABIN636087

Détail du produit anti-IL13RA2 anticorps

Antigène: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL13RA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: IL13 RA2 antibody was raised against the middle region of IL13 A2

Purification: Affinity purified

Immunogène: IL13 RA2 antibody was raised using the middle region of IL13 A2 corresponding to a region with amino acids GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL13RA2 Blocking Peptide, catalog no. 33R-3505, is also available for use as a blocking control in assays to test for specificity of this IL13RA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL13RA2

Antigène: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Autre désignation: IL13RA2 (IL13RA2 Produits)

Synonymes: anticorps il-13ra2, anticorps sb:cb602, anticorps si:dkeyp-110c7.6, anticorps CD213A2, anticorps CT19, anticorps IL-13R, anticorps IL13BP, anticorps CD213a2, anticorps IL-13R-alpha-2, anticorps IL13RA2, anticorps interleukin 13 receptor, alpha 2, anticorps interleukin 13 receptor subunit alpha 2, anticorps interleukin 13 receptor subunit alpha 2 S homeolog, anticorps il13ra2, anticorps IL13RA2, anticorps il13ra2.S, anticorps Il13ra2

Sujet: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.

Poids moléculaire: 42 kDa (MW of target protein)