SLC22A6 anticorps

N° du produit ABIN636097

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC22A6 dans WB. Il présente une réactivité envers Humain, Rat et Souris.

Aperçu rapide pour SLC22A6 anticorps (ABIN636097)

Antigène: SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC22A6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC22A6 anticorps

Purification: Affinity purified

Immunogène: SLC22 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC22A6 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLC22A6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC22A6

Antigène: SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))

Autre désignation: SLC22A6

Sujet: SLC22A6 is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport