NKAIN4 anticorps (N-Term)

N° du produit ABIN636103

Cet anticorps Lapin Polyclonal détecte spécifiquement NKAIN4 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour NKAIN4 anticorps (N-Term) (ABIN636103)

Antigène: NKAIN4 (Na+/K+ Transporting ATPase Interacting 4 (NKAIN4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NKAIN4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NKAIN4 anticorps

Épitope: N-Term

Specificité: NKAIN4 antibody was raised against the N terminal of NKAIN4

Purification: Affinity purified

Immunogène: NKAIN4 antibody was raised using the N terminal of NKAIN4 corresponding to a region with amino acids MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NKAIN4 Blocking Peptide, (ABIN5615002), is also available for use as a blocking control in assays to test for specificity of this NKAIN4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKAIN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NKAIN4

Antigène: NKAIN4 (Na+/K+ Transporting ATPase Interacting 4 (NKAIN4))

Autre désignation: NKAIN4

Sujet: The specific function of NKAIN4 is not yet known.

Poids moléculaire: 23 kDa (MW of target protein)