UGT2B15 anticorps (N-Term)

N° du produit ABIN636105

Détail du produit anti-UGT2B15 anticorps

Antigène: UGT2B15 (UDP Glucuronosyltransferase 2 Family, Polypeptide B15 (UGT2B15))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGT2B15 est non-conjugé

Application: Western Blotting (WB)

Specificité: UGT2 B15 antibody was raised against the N terminal of µgT2 15

Purification: Affinity purified

Immunogène: UGT2 B15 antibody was raised using the N terminal of µgT2 15 corresponding to a region with amino acids IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGT2B15 Blocking Peptide, catalog no. 33R-4025, is also available for use as a blocking control in assays to test for specificity of this µgT2B15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGT2B15

Antigène: UGT2B15 (UDP Glucuronosyltransferase 2 Family, Polypeptide B15 (UGT2B15))

Autre désignation: UGT2B15 (UGT2B15 Produits)

Synonymes: anticorps UGT2B28, anticorps HLUG4, anticorps UDPGT 2B8, anticorps UDPGT2B15, anticorps UDPGTH3, anticorps UGT2B8, anticorps UDP-glucuronosyltransferase 2B15, anticorps UDP glucuronosyltransferase family 2 member B15, anticorps LOC461289, anticorps LOC100591991, anticorps UGT2B15

Sujet: The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis