CYB561 anticorps (Middle Region)

N° du produit ABIN636106

Détail du produit anti-CYB561 anticorps

Antigène: CYB561 (Cytochrome B-561 (CYB561))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYB561 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYB561 antibody was raised against the middle region of CYB561

Purification: Affinity purified

Immunogène: CYB561 antibody was raised using the middle region of CYB561 corresponding to a region with amino acids LFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYB561 Blocking Peptide, catalog no. 33R-4943, is also available for use as a blocking control in assays to test for specificity of this CYB561 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYB561 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYB561

Antigène: CYB561 (Cytochrome B-561 (CYB561))

Autre désignation: CYB561 (CYB561 Produits)

Synonymes: anticorps CYB561A1, anticorps FRRS2, anticorps ECK1410, anticorps JW5224, anticorps MGC69260, anticorps zgc:193680, anticorps zgc:193701, anticorps ACYB-1, anticorps MBB18.18, anticorps MBB18_18, anticorps cytochrome B561-1, anticorps xcyt, anticorps cytochrome b561, anticorps cytochrome b-561, anticorps cytochrome B561-1, anticorps cytochrome b561 L homeolog, anticorps CYB561, anticorps cytb561, anticorps cybB, anticorps LOC5576849, anticorps LOC5576850, anticorps Cyb561, anticorps cyb561, anticorps CYB-1, anticorps cyb561.L, anticorps LOC100347599

Sujet: CYB561 is a senescene-associated protein in normal human oral keratinocytes.

Poids moléculaire: 27 kDa (MW of target protein)