SLC20A2 anticorps

N° du produit ABIN636107

L’anticorps Lapin Polyclonal anti-SLC20A2 a été validé pour WB. Il convient pour détecter SLC20A2 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour SLC20A2 anticorps (ABIN636107)

Antigène: SLC20A2 (Solute Carrier Family 20 (Phosphate Transporter), Member 2 (SLC20A2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC20A2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC20A2 anticorps

Purification: Affinity purified

Immunogène: SLC20 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC20A2 Blocking Peptide, (ABIN937607), is also available for use as a blocking control in assays to test for specificity of this SLC20A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC20A2

Antigène: SLC20A2 (Solute Carrier Family 20 (Phosphate Transporter), Member 2 (SLC20A2))

Autre désignation: SLC20A2

Sujet: SLC20A2 is a sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. It may play a role in extracellular matrix, cartilage and vascular calcification.

Poids moléculaire: 70 kDa (MW of target protein)