SLC20A2 anticorps

N° du produit ABIN636107

Détail du produit anti-SLC20A2 anticorps

Antigène: SLC20A2 (Solute Carrier Family 20 (Phosphate Transporter), Member 2 (SLC20A2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC20A2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC20 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC20A2 Blocking Peptide, catalog no. 33R-2221, is also available for use as a blocking control in assays to test for specificity of this SLC20A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC20A2

Antigène: SLC20A2 (Solute Carrier Family 20 (Phosphate Transporter), Member 2 (SLC20A2))

Autre désignation: SLC20A2 (SLC20A2 Produits)

Synonymes: anticorps wu:fi23g11, anticorps zgc:152990, anticorps glvr-2, anticorps glvr2, anticorps mlvar, anticorps pit-2, anticorps pit2, anticorps SLC20A2, anticorps GLVR-2, anticorps GLVR2, anticorps IBGC3, anticorps MLVAR, anticorps PIT-2, anticorps PIT2, anticorps RAM1, anticorps Ab1-188, anticorps Glvr2, anticorps Pit-2, anticorps RAM-1, anticorps Ram1, anticorps MolPit2, anticorps Pit2, anticorps Ram-1, anticorps ChoPit2, anticorps HaPit2, anticorps PiT-2, anticorps solute carrier family 20 member 2, anticorps solute carrier family 20 (phosphate transporter), member 2, anticorps solute carrier family 20 (phosphate transporter), member 2 L homeolog, anticorps solute carrier family 20, member 2, anticorps SLC20A2, anticorps slc20a2, anticorps slc20a2.L, anticorps Slc20a2

Sujet: SLC20A2 is a sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. It may play a role in extracellular matrix, cartilage and vascular calcification.

Poids moléculaire: 70 kDa (MW of target protein)