SLC19A3 anticorps (Middle Region)

N° du produit ABIN636108

Cet anticorps anti-SLC19A3 est un anticorps Lapin Polyclonal détectant SLC19A3 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour SLC19A3 anticorps (Middle Region) (ABIN636108)

Antigène: SLC19A3 (Slc19a3) (Solute Carrier Family 19, Member 3 (Slc19a3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC19A3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC19A3 anticorps

Épitope: Middle Region

Specificité: SLC19 A3 antibody was raised against the middle region of SLC19 3

Purification: Affinity purified

Immunogène: SLC19 A3 antibody was raised using the middle region of SLC19 3 corresponding to a region with amino acids FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC19A3 Blocking Peptide, (ABIN938234), is also available for use as a blocking control in assays to test for specificity of this SLC19A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC19A3

Antigène: SLC19A3 (Slc19a3) (Solute Carrier Family 19, Member 3 (Slc19a3))

Autre désignation: SLC19A3

Sujet: SLC19A3 mediates high affinity thiamine uptake, propably via a proton anti-port mechanism. SLC19A3 has no folate transport activity.SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport