FAAH2 anticorps (C-Term)

N° du produit ABIN636114

Détail du produit anti-FAAH2 anticorps

Antigène: FAAH2 (Fatty Acid Amide Hydrolase 2 (FAAH2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAAH2 est non-conjugé

Application: Western Blotting (WB)

Specificité: FAAH2 antibody was raised against the C terminal of FAAH2

Purification: Affinity purified

Immunogène: FAAH2 antibody was raised using the C terminal of FAAH2 corresponding to a region with amino acids SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAAH2 Blocking Peptide, catalog no. 33R-8683, is also available for use as a blocking control in assays to test for specificity of this FAAH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAAH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAAH2

Antigène: FAAH2 (Fatty Acid Amide Hydrolase 2 (FAAH2))

Autre désignation: FAAH2 (FAAH2 Produits)

Synonymes: anticorps AMDD, anticorps fatty acid amide hydrolase 2, anticorps FAAH2

Sujet: Fatty acid amide hydrolases, such as FAAH1 and FAAH2, hydrolyze primary fatty acid amide substrates and may play a role in fatty acid catabolism.

Poids moléculaire: 58 kDa (MW of target protein)