AMH anticorps

N° du produit ABIN643496

L’anticorps anti-AMH Monoclonal Souris est utilisé pour la détection de AMH dans des échantillons de Humain. Il a été validé pour IHC (p).

Aperçu rapide pour AMH anticorps (ABIN643496)

Antigène: AMH (Anti-Mullerian Hormone (AMH))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp AMH est non-conjugé

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-AMH anticorps

Fonction: Mouse Anti-Human AMH

Specificité: DS-MB-02769 is specific for human anti-mullerian hormone (AMH), originally classified as a fetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. DS-MB-02769 is reported to crossreact with mouse.

Immunogène: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)

Isotype: IgG1

Information d'application

Restrictions: For Research Use only

Stockage

Format: Liquid

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: -20°C

Détails sur AMH

Antigène: AMH (Anti-Mullerian Hormone (AMH))

Autre désignation: AMH

Pathways: Negative Regulation of Hormone Secretion