RBBP4 / RbAp48 / NURF55 anticorps

N° du produit ABIN6654058

L’anticorps Souris Monoclonal anti- a été validé pour IHC (p) et WB. Il convient pour détecter dans des échantillons de Humain.

Aperçu rapide pour RBBP4 / RbAp48 / NURF55 anticorps (ABIN6654058)

Antigène: RBBP4 / RbAp48 / NURF55

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Inconjugué

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)

Clone: 9F3

Détail du produit

Purification: Protein G affinity

Immunogène: Amino acids EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS were used as the immunogen for the RbAp48 antibody.

Isotype: IgG1

Information d'application

Indications d'application: Optimal dilution of the RbAp48 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,Immunohistochemistry (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the RbAp48 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détail du antigène

Antigène: RBBP4 / RbAp48 / NURF55

Sujet: Histone-binding protein RBBP4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.

UniProt: Q09028