CD1b anticorps

N° du produit ABIN6654113

Cet anticorps anti-CD1b est un anticorps Lapin Polyclonal détectant CD1b dans WB et IHC (p). Adapté pour Humain, Souris et Rat.

Aperçu rapide pour CD1b anticorps (ABIN6654113)

Antigène: CD1b (CD1B)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CD1b est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-CD1b anticorps

Purification: Antigen affinity purified

Immunogène: Amino acids DKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY were used as the immunogen for the CD1b antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CD1b antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CD1b antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CD1b

Antigène: CD1b (CD1B)

Autre désignation: CD1b

Sujet: CD1b is a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens.

UniProt: P29016