Sucrase Isomaltase anticorps

N° du produit ABIN6654192

Cet anticorps Lapin Polyclonal détecte spécifiquement Sucrase Isomaltase dans WB et IHC (p). Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour Sucrase Isomaltase anticorps (ABIN6654192)

Antigène: Sucrase Isomaltase (SI) (Sucrase-Isomaltase (Alpha-Glucosidase) (SI))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sucrase Isomaltase est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-Sucrase Isomaltase anticorps

Purification: Antigen affinity purified

Immunogène: Amino acids FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID were used as the immunogen for the Sucrase Isomaltase antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Sucrase Isomaltase antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Sucrase Isomaltase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Sucrase Isomaltase

Antigène: Sucrase Isomaltase (SI) (Sucrase-Isomaltase (Alpha-Glucosidase) (SI))

Autre désignation: SI / Sucrase Isomaltase

Sujet: This gene is mapped to 3q26.1. It encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.

UniProt: P14410