EWSR1 anticorps (Middle Region)

N° du produit ABIN6719313

Détail du produit anti-EWSR1 anticorps

Antigène: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Épitope: AA 369-399, Middle Region

Reactivité: Humain, Souris, Singe

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp EWSR1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Mouse IgG monoclonal antibody for EWSR1 detection. Tested with WB, IHC-P in Human,Mouse,Monkey.

Séquence: NDSVTLDDLA DFFKQCGVVK MNKRTGQPMI H

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Mouse IgG monoclonal antibody for EWSR1 detection. Tested with WB, IHC-P in Human,Mouse,Monkey.

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.

Clone: 4B4

Isotype: IgG

Information d'application

Indications d'application:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL

Commentaires:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur EWSR1

Antigène: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Autre désignation: EWSR1 (EWSR1 Produits)

Synonymes: anticorps EWS, anticorps bK984G1.4, anticorps AU018891, anticorps Ews, anticorps Ewsh, anticorps EWSR1, anticorps fc04c01, anticorps wu:fc04c01, anticorps DKFZp459K1116, anticorps ewsr1, anticorps ewsr1.S, anticorps fb40b11, anticorps fusl, anticorps wu:fb40b11, anticorps wu:fb75g09, anticorps zgc:55864, anticorps EWS RNA binding protein 1, anticorps Ewing sarcoma breakpoint region 1, anticorps EWS RNA-binding protein 1, anticorps EWS RNA-binding protein 1a, anticorps EWS RNA binding protein 1 L homeolog, anticorps EWS RNA-binding protein 1b, anticorps EWSR1, anticorps Ewsr1, anticorps ewsr1a, anticorps ewsr1, anticorps ewsr1.L, anticorps ewsr1b

Sujet:

Synonyms: RNA-binding protein EWS, EWS oncogene, Ewing sarcoma breakpoint region 1 protein, EWSR1, EWS

Background: This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

ID gène: 2130

UniProt: Q01844