NPPB anticorps (AA 1-32)

N° du produit ABIN6757749

Cet anticorps anti-NPPB est un anticorps Souris Monoclonal détectant NPPB dans ELISA. Adapté pour Humain.

Aperçu rapide pour NPPB anticorps (AA 1-32) (ABIN6757749)

Antigène: NPPB (Natriuretic Peptide Precursor B (NPPB))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp NPPB est non-conjugé

Application: ELISA

Clone: 21-Mar

Détail du produit anti-NPPB anticorps

Épitope: AA 1-32

Specificité: Recognizes synthetic human Brain Natriuretic Peptide (aa 1-32).

Homologie: Percent identity by BLAST analysis: Human, Gibbon (100%).

Purification: Protein G purified

Immunogène: Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH). Percent identity by BLAST analysis: Human, Gibbon (100%).

Isotype: IgG2b

Information d'application

Indications d'application: Approved: ELISA

Usage: Suitable for use in ELISA.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from PBS,  pH 7.2

Stock: 4 °C,-20 °C

Stockage commentaire: Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.

Détails sur NPPB

Antigène: NPPB (Natriuretic Peptide Precursor B (NPPB))

Autre désignation: NPPB / BNP

Sujet: Name/Gene ID: NPPB

Synonyms: NPPB, BNP, Natriuretic peptides B, Natriuretic peptide B, Natriuretic protein, Brain type natriuretic peptide

ID gène: 4879

UniProt: P16860

Pathways: Hormone Activity