CLCN3 anticorps (C-Term, Intracellular)

N° du produit ABIN7043052

Cet anticorps anti-CLCN3 Polyclonal Lapin (ABIN7043052) détecte spécifiquement CLCN3 dans WB, IHC, IF, IC et IP. L’anticorps est réactif avec des échantillons de Rat.

Aperçu rapide pour CLCN3 anticorps (C-Term, Intracellular) (ABIN7043052)

Antigène: CLCN3 (Chloride Channel 3 (CLCN3))

Reactivité: Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLCN3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunochromatography (IC), Immunoprecipitation (IP)

Classe de qualité: KO Validated

Détail du produit anti-CLCN3 anticorps

Épitope: AA 592-661, C-Term, Intracellular

Fonction: A Rabbit Polyclonal Antibody to CLC-3 (CLCN3) Channel

Réactivité croisée: Humain, Rat

Homologie: rat CLC-5 - 49,70 amino acid residues identicalRat CLC-4 - 46, human,70 amino acid residues identical,rabbit,guinea pig - 69,Mouse - identical, Xenopus laevis - 61

Attributs du produit: Anti- (CLCN3) Antibody (ABIN7043052, ABIN7044121 and ABIN7044122) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot and immunohistochemistry applications. It has been designed to recognize from rat, mouse, and human samples.

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogène: GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3

Isotype: IgG

Information d'application

Indications d'application:

WB: 1:200

FC: The optimal concentration should be determined by the user

ICC: The optimal concentration should be determined by the user

IHC: The optimal concentration should be determined by the user

IP: The optimal concentration should be determined by the user

Commentaires:

Cited Application: IHC|ICC

Negative Control: (ABIN7235086)

Blocking Peptide: (ABIN7235086)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.

Concentration: 0.8 mg/mL

Buffer: PBS pH 7.4, 1 % BSA with 0.05 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Détails sur CLCN3

Antigène: CLCN3 (Chloride Channel 3 (CLCN3))

Autre désignation: CLCN3

Sujet:

Synonyms: Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3

Description: CLC-3 is a member of the voltage-dependent Cl- channel (CLC) family that includes nine known members in mammals. CLC channels can be classified as plasma membrane channels and intracellular organelle channels. The first group includes the CLC-1, CLC-2 CLC-Ka and CLCKb channels. The second group comprises the CLC-3, CLC-4, CLC-5, CLC-6 and CLC-7.CLC channels that function in the plasma membrane are involved in the stabilization of membrane potential and in transepithelial transport. The presumed function of the intracellular CLC channels is support of the acidification of the intraorganellar compartment. In this regard, recent reports indicate that ClC-4 and ClC-5 (and by inference ClC-3) can function as Cl-/H+ antiporters.1, 2The functional unit of the CLC channels is a dimer with each subunit forming a proper pore. Although the crystal structure of bacterial CLC channels was resolved, the topology of the CLC channels is complex and has not been fully elucidated. It is generally accepted that both the N- and C- terminus domains are intracellular while the number and configuration of the transmembrane domains vary greatly between different models. 1,2CLC-3 is widely distributed with prominent expression in tissues of neuroectoderm origin. In the brain, it is highly expressed in the hippocampus, olfactory bulb and olfactory cortex. The channel is also prominently expressed in aortic and coronary vascular smooth muscle cells, aortic endothelial cells and tracheal and alveolar epithelial cells.The physiological function of CLC-3 is not entirely clear, but it has been suggested that CLC-3 generates a shunt current of chloride for v-H+-ATPases, thereby aiding the acidification of endosomes and synaptic vesicles as well as lysosomes. Disruption of the ClC-3 gene in mice causes severe neuronal loss, leading to a complete loss of the hippocampus in adult mice. In addition, CLC-3 has been shown to have a critical role in the respiratory burst and phagocytosis of polymorphonuclear cells, a key cell type of innate host defense. 3,4

ID gène: 84360

NCBI Accession: NM_001243372

UniProt: P51792