DLG2 anticorps (AA 336-379)

N° du produit ABIN7043102

Détail du produit anti-DLG2 anticorps

Antigène: DLG2 (Discs, Large Homolog 2 (DLG2))

Épitope: AA 336-379

Reactivité: Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLG2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunofluorescence (IF), Immunocytochemistry (ICC)

Attributs du produit: Anti-PSD-93 Antibody (ABIN7043102, ABIN7045142 and ABIN7045143)) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot, immunoprecipitation, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize PSD-93 from rat, mouse, and human samples.

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogène:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.

Concentration: 1 mg/mL

Buffer: Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: RT,4 °C,-20 °C

Stockage commentaire:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Détails sur DLG2

Antigène: DLG2 (Discs, Large Homolog 2 (DLG2))

Autre désignation: PSD-93 (DLG2 Produits)

Synonymes: anticorps PPP1R58, anticorps PSD-93, anticorps PSD93, anticorps chapsyn-110, anticorps A330103J02Rik, anticorps B230218P12Rik, anticorps B330007M19Rik, anticorps Dlgh2, anticorps Gm1197, anticorps discs, large homolog 2 (Drosophila), anticorps discs large MAGUK scaffold protein 2, anticorps dlg2, anticorps DLG2, anticorps Dlg2

Sujet: Alternative names: PSD-93, Discs large homolog 2, Dlg2, Chapsyn-110

ID gène: 64053

NCBI Accession: NM_001364

UniProt: Q63622