DLG3 anticorps (AA 93-124)

N° du produit ABIN7043103

Cet anticorps anti-DLG3 est un anticorps Lapin Polyclonal détectant DLG3 dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour DLG3 anticorps (AA 93-124) (ABIN7043103)

Antigène: DLG3 (Discs, Large Homolog 3 (DLG3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLG3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-DLG3 anticorps

Épitope: AA 93-124

Fonction: A Rabbit Polyclonal Antibody to SAP-102

Specificité: N-terminal domain

Réactivité croisée: Rat

Homologie: Rat,mouse - 26,32 amino acid residues identical

Attributs du produit: Anti-SAP102 Antibody is directed against an epitope located at the N-terminal region of the human . Anti-SAP102 Antibody (ABIN7043103 and ABIN7045144) can be used in western blot and immunohistochemistry applications, and has been designed to recognize from rat, mouse and human samples.

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogène:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93-124 of human SAP102

Isotype: IgG

Information d'application

Indications d'application:

Antigen preadsorption control: 3 μg fusion protein per 1 μg antibody

Application Dilutions Immunohistochemistry paraffin embedded sections ihc: N/A

Application Dilutions Western blot wb: 1:400

Commentaires:

Negative Control: (ABIN7235227)

Blocking Peptide: (ABIN7235227)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Recosntitute with double distilled water (DDW) to a concentration of 1.0 mg/mL.

Concentration: 1 mg/mL

Buffer: PBS pH 7.4

Stock: 4 °C,-20 °C

Stockage commentaire:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Détails sur DLG3

Antigène: DLG3 (Discs, Large Homolog 3 (DLG3))

Autre désignation: DLG3

Sujet: Synapse-associated protein 102, SAP-102, Discs large homolog 3, DLG3, NE-DLG,SAP-102 (also known as DLG3) is a PDZ containing domain protein that is also a member of the membrane-associated guanylate kinase (MAGUK) family of multi-domain adaptor proteins1,2.PDZ domains are conserved protein domains of about 90 amino acids involved in protein-protein recognition, protein targeting and assembly of multi-protein complexes. The name PDZ derives from the first three proteins in which these domains were identified: PSD-95 (a 95 kDa protein involved in signaling at the post-synaptic density), DLG (the Drosophila melanogaster Discs large protein) and ZO-1 (the zonula occludens 1 protein involved in maintenance of epithelial polarity)1,2.MAGUKs are scaffolding proteins that comprise several modular protein binding motifs including one or more PDZ domains, a Src homology 3 (SH3) domain, and a catalytically inactive guanylate kinase-like domain1,2.The multidomain nature of PDZ-containing proteins enables them to interact with multiple binding partners and hence organize larger signaling protein complexes.SAP-102 has been shown to participate in the postsynaptic density, a dedicated structure formed in postsynaptic nerve terminals that includes a specialized assembly of ion channels, receptors and signaling molecules that are involved in information processing and the modulation of synaptic plasticity1,2. Moreover, mutations in the SAP102 gene have been linked with a form of mental retardation3.

Alternative names: SAP102, Synapse-associated protein 102, SAP-102, Discs large homolog 3, DLG3, NE-DLG

ID gène: 1741

NCBI Accession: NM_021120

UniProt: Q92796