PPP1R8 anticorps

N° du produit ABIN7272976

Cet anticorps anti-PPP1R8 Polyclonal Chèvre (ABIN7272976) détecte spécifiquement PPP1R8 dans WB. L’anticorps est réactif avec des échantillons de Archaeoprepona.

Aperçu rapide pour PPP1R8 anticorps (ABIN7272976)

Antigène: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Reactivité: Archaeoprepona

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP1R8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PPP1R8 anticorps

Fonction: Anti-ARD1

Séquence: MDKLIGSCVW GAVNYTSNCR AECKRRGYKG GHCGSFANVN CWCET

Specificité: Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin

Réactivité croisée (Details): Archeoprepona genus

Attributs du produit: Chain A defensin ARD1

Purification: Epitope affinity purified

Immunogène: Purified recombinant defensin ARD1 (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli

Isotype: IgG

Information d'application

Indications d'application: WB:1:500-1:2,000

Restrictions: For Research Use only

Stockage

Concentration: 2 mg/mL

Buffer: PBS, 20 % glycerol and 0.05 % sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: The antibody solution should be gently mixed before use.

Stock: 4 °C,-20 °C

Stockage commentaire: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.

Détails sur PPP1R8

Antigène: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Autre désignation: ARD1

Sujet:

Goat polyclonal antibody to Chain A defensin ARD1. This peptide isolated from one-spotted leafwing butterfly and moth has been shown to have antimicrobial properties.

Heliomycin, ETD135, ETD151 antibody.