SARS-CoV-2 ORF8 anticorps

N° du produit ABIN7603757

Cet anticorps anti-SARS-CoV-2 ORF8 est un anticorps Lapin Polyclonal détectant SARS-CoV-2 ORF8 dans ELISA. Adapté pour Humain.

Aperçu rapide pour SARS-CoV-2 ORF8 anticorps (ABIN7603757)

Antigène: SARS-CoV-2 ORF8

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SARS-CoV-2 ORF8 est non-conjugé

Application: ELISA

Détail du produit anti-SARS-CoV-2 ORF8 anticorps

Fonction: Anti-SARS-CoV-2 ORF8 Antibody

Séquence: AAFHQECSLQ SCTQHQPYVV DDPCPIHFYS KWYIRVGARK SAPLIELCVD EAGSKSPIQY IDIGNYTVSC LPFTINCQEP KLGSLVVRCS FYEDFLEYHD VRVVLDFI

Attributs du produit: Anti-SARS-CoV-2 ORF8 Antibody (ABIN7603757). Tested in ELISA applications. This antibody reacts with Human.

Purification: Immunogen affinity purified.

Immunogène: AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Isotype: IgG

Information d'application

Indications d'application: ELISA, 0.001-0.1 μg/mL, Human1. Gordon DE, et al. Nature, 2020 Jul. 2. Gordon DE, et al. Science, 2020 Oct 15. 3. Li JY, et al. Virus Res, 2020 Sep. 4. Wu F, et al. Nature, 2020 Mar.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Stock: 4 °C,-20 °C

Stockage commentaire: Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Détails sur SARS-CoV-2 ORF8

Antigène: SARS-CoV-2 ORF8

Sujet:

Synonyms: ORF8 protein, ORF8, Non-structural protein 8, ns8

Tissue Specificity: Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. .

Background: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF8 encodes a viral accessory protein.

Poids moléculaire: 140 kDa, 130 kDa, 110 kDa

ID gène: 43740577