EXT1 anticorps

N° du produit ABIN7616846

L’anticorps Souris Monoclonal anti-EXT1 a été validé pour WB, IHC, IP et ICC. Il convient pour détecter EXT1 dans des échantillons de Différentes espèces.

Aperçu rapide pour EXT1 anticorps (ABIN7616846)

Antigène: EXT1 (Exostosin 1 (EXT1))

Reactivité: Différentes espèces

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp EXT1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Clone: C2

Détail du produit anti-EXT1 anticorps

Fonction: Exenatide (EXT) Monoclonal Antibody

Attributs du produit: The Exenatide (EXT) Monoclonal Antibody (Species: Universal) has been validated for the following applications: WB, IHC, ICC, IP.

Purification: Protein A + Protein G affinity chromatography

Immunogène: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Isotype: IgG2a kappa

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 1 mg/mL

Buffer: 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol

Agent conservateur: ProClin

Précaution d'utilisation: This product contains ProClin: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: 2°C to 8°C for frequent use, -20°C for 12 months. Avoid repeated freeze/thaw cycles.

Date de péremption: 12 months

Détails sur EXT1

Antigène: EXT1 (Exostosin 1 (EXT1))

Autre désignation: EXT

UniProt: P26349

Pathways: Glycosaminoglycan Metabolic Process