Actin-Like 6B anticorps (AA 39-114) (FL650)

N° du produit ABIN7823682

Cet anticorps anti-Actin-Like 6B Monoclonal Souris conjugué à FL650 (Clone N332B-15) (ABIN7823682) détecte spécifiquement Actin-Like 6B dans IHC et ICC. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour Actin-Like 6B anticorps (AA 39-114) (FL650) (ABIN7823682)

Antigène: Actin-Like 6B (ACTL6B)

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Actin-Like 6B est conjugé à/à la FL650

Application: Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Classe de qualité: KO Validated

Clone: N332B-15

Détail du produit anti-Actin-Like 6B anticorps (FL650)

Épitope: AA 39-114

Fonction: Anti-BAF53b Antibody FL650 Conjugate

Séquence: TTVGLLAAEE GGGLELEGDK EKKGKIFHID TNALHVPRDG AEVMSPLKNG MIEDWECFRA ILDHTYSKHV KSEPNL

Specificité: No off-targets reported for BAF53a

Réactivité croisée: Souris

Attributs du produit: Our Anti-BAF53b mouse monoclonal primary antibody is produced in-house from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by protein a chromatography. It is great for use in IHC, ICC.

Purification: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.

Pureté: Purified mAbs are >90 % specific antibody.

Immunogène: Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli

Isotype: IgG1

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: PBS with 0.09 % azide7.4

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: For maximum recovery of product, centrifuge the vial prior to removing the cap.

Stock: 4 °C,-20 °C

Stockage commentaire: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C.

Date de péremption: 12 months

Détails sur Actin-Like 6B

Antigène: Actin-Like 6B (ACTL6B)

Autre désignation: BAF53b

Sujet:

Synonyms: Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)

Description Logic: Our Anti-BAF53b mouse monoclonal primary antibody is produced from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by protein a chromatography. It is great for use in IHC, ICC.

Gene Name Alternatives: ACTL6B ACTL6 BAF53B

Poids moléculaire: 53 kDa

UniProt: O94805