SVOP anticorps (Cytosolic, N-Term)

N° du produit ABIN7824544

Cet anticorps Souris Monoclonal détecte spécifiquement SVOP dans WB, ELISA et ICC. Il présente une réactivité envers Rat.

Aperçu rapide pour SVOP anticorps (Cytosolic, N-Term) (ABIN7824544)

Antigène: SVOP (Synaptic Vesicle 2-Related Protein (SVOP))

Reactivité: Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp SVOP est non-conjugé

Application: Western Blotting (WB), ELISA, Immunocytochemistry (ICC)

Classe de qualité: KO Validated

Clone: N356-23

Détail du produit anti-SVOP anticorps

Épitope: AA 1-85, Cytosolic, N-Term

Fonction: Anti-SVOP Antibody

Séquence: MEEDLFQLRQ LPVVKFRRTG ESARSEDDAA SGEHDVQIEG VRVGLEAVEL DDGAAVPKEF ANPTDDTFMV EDAVEAIGFG RFQWK

Specificité: No off-targets reported for SVOPL/SVOP2

Réactivité croisée: Souris

Attributs du produit: Our Anti-SVOP mouse monoclonal primary antibody is produced in-house from hybridoma clone N356/23. It is KO validated, detects mouse and rat SVOP, and is purified by protein a chromatography. It is great for use in WB, ICC, ELISA.

Purification: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.

Pureté: Purified mAbs are >90 % specific antibody.

Immunogène: Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (accession number Q9Z2I7) produced recombinantly in E. Coli

Isotype: IgG1

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 1 mg/mL

Buffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065 % Sodium Azide 7.4

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: For maximum recovery of product, centrifuge the vial prior to removing the cap.

Stock: 4 °C,-20 °C

Stockage commentaire: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C.

Date de péremption: 24 months

Détails sur SVOP

Antigène: SVOP (Synaptic Vesicle 2-Related Protein (SVOP))

Autre désignation: SVOP

Sujet:

Synonyms: Synaptic vesicle 2-related protein (SV2-related protein)

Description Logic: Our Anti-SVOP mouse monoclonal primary antibody is produced from hybridoma clone N356/23. It is KO validated, detects mouse and rat SVOP, and is purified by protein a chromatography. It is great for use in WB, ICC, ELISA.

Gene Name Alternatives: Svop

Poids moléculaire: 60 kDa

UniProt: Q9Z2I7