ACO2 anticorps (AA 561-596)

N° du produit ABIN7875784

Cet anticorps anti-ACO2 Monoclonal Souris (Clone 4C12D1) (ABIN7875784) détecte spécifiquement ACO2 dans WB et IHC (p). L’anticorps est réactif avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour ACO2 anticorps (AA 561-596) (ABIN7875784)

Antigène: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Reactivité: Humain, Rat, Souris

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp ACO2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 4C12D1

Détail du produit anti-ACO2 anticorps

Épitope: AA 561-596

Fonction: ACO2 Antibody / Aconitase 2

Séquence: TSQRLQLLEP FDKWDGKDLE DLQILIKVKG KCTTDH

Purification: Antigen affinity purified

Immunogène: Amino acids 561-596 (TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH) were used as the immunogen for the ACO2 antibody.

Isotype: IgG1

Information d'application

Indications d'application: Optimal dilution of the ACO2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the ACO2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ACO2

Antigène: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Autre désignation: ACO2

Sujet: Aconitase 2, mitochondrial (also called Aconitate hydratase, mitochondrial) is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15 (PRSS15), also known as Lon protease, after oxidative modification.

UniProt: Q99798