GDF9 anticorps (C-Term)

N° du produit ABIN7877390

Cet anticorps Souris Monoclonal détecte spécifiquement GDF9 dans WB, ELISA et IHC (p). Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour GDF9 anticorps (C-Term) (ABIN7877390)

Antigène: GDF9 (Growth Differentiation Factor 9 (GDF9))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp GDF9 est non-conjugé

Application: Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Classe de qualité: Carrier-free

Clone: GDF9-4261

Détail du produit anti-GDF9 anticorps

Épitope: C-Term

Fonction: GDF9 Antibody (azide and preservative free)

Séquence: VPAKYSPLSV LTIEPDGSIA YKEYEDMIAT KC

Purification: Protein G affinity chromatography

Immunogène: Amino acids VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from the C-terminal region of human GDF9 were used as the immunogen for the GDF9 antibody. The epitope has been mapped to amino acids EPDG.

Isotype: IgG1

Information d'application

Indications d'application: Optimal dilution of the GDF9 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 1 mg/mL

Buffer: 1 mg/mL in 1X PBS, BSA free, sodium azide free

Agent conservateur: Azide free

Stock: 4 °C,-20 °C

Stockage commentaire: Store the GDF9 antibody at 2-8oC (with azide) or aliquot and store at -20oC or colder (without azide).

Détails sur GDF9

Antigène: GDF9 (Growth Differentiation Factor 9 (GDF9))

Autre désignation: GDF9

Sujet: GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

UniProt: O60383