HSPA9 anticorps (C-Term)

N° du produit ABIN7877395

Cet anticorps anti-HSPA9 Monoclonal Souris (Clone 4I9) (ABIN7877395) détecte spécifiquement HSPA9 dans WB, IF, FACS et IHC (p). L’anticorps est réactif avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour HSPA9 anticorps (C-Term) (ABIN7877395)

Antigène: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Reactivité: Humain, Rat, Souris

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp HSPA9 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 4I9

Détail du produit anti-HSPA9 anticorps

Épitope: C-Term

Fonction: HSPA9 Antibody / GRP75

Séquence: KLFEMAYKKM ASEREGSGSS GTGEQKEDQK EEKQ

Purification: Affinity purified

Immunogène: C-terminal region amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ from the human protein were used as the immunogen for the HSPA9 antibody.

Isotype: IgG1

Information d'application

Indications d'application: Optimal dilution of the HSPA9 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the HSPA9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur HSPA9

Antigène: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Autre désignation: HSPA9

Sujet: HSPA9 (heat shock 70 kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

UniProt: P38646