PDIA3 anticorps (C-Term)

N° du produit ABIN7877463

L’anticorps anti-PDIA3 Monoclonal Souris est utilisé pour la détection de PDIA3 dans des échantillons de Humain. Il a été validé pour WB, IHC (p) et FACS.

Aperçu rapide pour PDIA3 anticorps (C-Term) (ABIN7877463)

Antigène: PDIA3 (Protein Disulfide Isomerase Family A, Member 3 (PDIA3))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp PDIA3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Clone: 7E5-

Détail du produit anti-PDIA3 anticorps

Épitope: C-Term

Fonction: ERp57 Antibody / PDIA3

Séquence: RELSDFISYL QREATNPPVI QEEKPKKKKK AQEDL

Purification: Antigen affinity purified

Immunogène: C-terminal amino acids RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL were used as the immunogen for the ERp57 antibody.

Isotype: IgG1

Information d'application

Indications d'application: Optimal dilution of the ERp57 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the ERp57 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur PDIA3

Antigène: PDIA3 (Protein Disulfide Isomerase Family A, Member 3 (PDIA3))

Autre désignation: ERp57

Sujet: PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase, however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.

UniProt: P30101

Pathways: Maintenance of Protein Location, Protein targeting to Nucleus, Cell RedoxHomeostasis