RAB11A anticorps (C-Term)

N° du produit ABIN7877466

L’anticorps anti-RAB11A Monoclonal Souris est utilisé pour la détection de RAB11A dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB, IF, IHC (p) et FACS.

Aperçu rapide pour RAB11A anticorps (C-Term) (ABIN7877466)

Antigène: RAB11A (RAB11A, Member RAS Oncogene Family (RAB11A))

Reactivité: Humain, Souris, Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp RAB11A est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Clone: 4H9

Détail du produit anti-RAB11A anticorps

Épitope: C-Term

Fonction: RAB11A Antibody

Séquence: EIYRIVSQKQ MSDRRENDMS PSNNVVPIHV PPTTENKPKV Q

Purification: Antigen affinity purified

Immunogène: C-terminal region amino acids EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ from the human protein were used as the immunogen for the RAB11A antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the RAB11A antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the RAB11A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur RAB11A

Antigène: RAB11A (RAB11A, Member RAS Oncogene Family (RAB11A))

Autre désignation: RAB11A

Sujet: Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.

UniProt: P62491

Pathways: Regulation of Cell Size, Thromboxane A2 Receptor Signaling, Regulation of long-term Neuronal Synaptic Plasticity