DHODH anticorps (N-Term)

N° du produit ABIN7879597

Cet anticorps anti-DHODH Monoclonal Souris (Clone 2G7) (ABIN7879597) détecte spécifiquement DHODH dans WB et IHC (p). L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour DHODH anticorps (N-Term) (ABIN7879597)

Antigène: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Reactivité: Humain, Souris, Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp DHODH est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 2G7

Détail du produit anti-DHODH anticorps

Épitope: N-Term

Fonction: Dihydroorotate dehydrogenase Antibody / DHODH

Séquence: RVFRLPEDQA VINRYGFNSH GLSVVEHRLR ARQQKQAKLT E

Purification: Affinity purified

Immunogène: N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D from the human protein were used as the immunogen for the Dihydroorotate dehydrogenase antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the Dihydroorotate dehydrogenase antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the Dihydroorotate dehydrogenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur DHODH

Antigène: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Autre désignation: Dihydroorotate dehydrogenase

Sujet: Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

UniProt: Q02127

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus