DHODH anticorps (N-Term)

N° du produit ABIN7879598

Cet anticorps Souris Monoclonal détecte spécifiquement DHODH dans WB, IF et FACS. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour DHODH anticorps (N-Term) (ABIN7879598)

Antigène: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Reactivité: Humain, Souris, Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp DHODH est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS)

Clone: 4E3-

Détail du produit anti-DHODH anticorps

Épitope: N-Term

Fonction: DHODH Antibody / Dihydroorotate dehydrogenase

Séquence: RVFRLPEDQA VINRYGFNSH GLSVVEHRLR ARQQKQAKLT ED

Purification: Antigen affinity purified

Immunogène: N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED from the human protein were used as the immunogen for the DHODH antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the DHODH antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the DHODH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur DHODH

Antigène: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Autre désignation: DHODH

Sujet: Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

UniProt: Q02127

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus