AFF4 anticorps

N° du produit ABIN7879910

Cet anticorps Souris Monoclonal détecte spécifiquement AFF4 dans WB et FACS. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour AFF4 anticorps (ABIN7879910)

Antigène: AFF4 (AF4/FMR2 Family, Member 4 (AFF4))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp AFF4 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS)

Clone: 8G12

Détail du produit anti-AFF4 anticorps

Fonction: AFF4 Antibody

Séquence: RNVLRMKERE RRNQEIQQGE DAFPPSSPLF AEPYKVTSKE DKLSSRIQ

Purification: Affinity purified

Immunogène: Amino acids RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ from the human protein were used as the immunogen for the AFF4 antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the AFF4 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the AFF4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur AFF4

Antigène: AFF4 (AF4/FMR2 Family, Member 4 (AFF4))

Autre désignation: AFF4

Sujet: The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.

UniProt: Q9UHB7