AKR1D1 anticorps

N° du produit ABIN7879946

Cet anticorps Souris Monoclonal détecte spécifiquement AKR1D1 dans WB, FACS et IHC (p). Il présente une réactivité avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour AKR1D1 anticorps (ABIN7879946)

Antigène: AKR1D1 (Aldo-Keto Reductase Family 1, Member D1 (AKR1D1))

Reactivité: Humain, Rat, Souris

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp AKR1D1 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 6I4

Détail du produit anti-AKR1D1 anticorps

Fonction: AKR1D1 Antibody

Séquence: EEMKDIEALN KNVRFVELLM WRDHPEYPFH DEY

Purification: Affinity purified

Immunogène: Amino acids EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY from the human protein were used as the immunogen for the AKR1D1 antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the AKR1D1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the AKR1D1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur AKR1D1

Antigène: AKR1D1 (Aldo-Keto Reductase Family 1, Member D1 (AKR1D1))

Autre désignation: AKR1D1

Sujet: Human delta(4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.

UniProt: P51857

Pathways: Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process