CCR10 anticorps

N° du produit ABIN7880397

L’anticorps anti-CCR10 Polyclonal Lapin est utilisé pour la détection de CCR10 dans des échantillons de Humain. Il a été validé pour WB et IHC (p).

Aperçu rapide pour CCR10 anticorps (ABIN7880397)

Antigène: CCR10 (Chemokine (C-C Motif) Receptor 10 (CCR10))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCR10 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-CCR10 anticorps

Fonction: CCR10 Antibody

Séquence: TEATEQVSWG HYSGDEEDAY SAEPLPELCY KADVQAFSRA FQ

Purification: Antigen affinity purified

Immunogène: Amino acids TEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQ from the human protein were used as the immunogen for the CCR10 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CCR10 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the CCR10 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur CCR10

Antigène: CCR10 (Chemokine (C-C Motif) Receptor 10 (CCR10))

Autre désignation: CCR10

Sujet: C-C chemokine receptor type 10 is a protein that in humans is encoded by the CCR10 gene. It is mapped to 17q21.2. Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues, the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CCR10 is the receptor for CCL27 (SCYA27, MIM 604833), CCR10-CCL27 interactions are involved in T cell-mediated skin inflammation.

UniProt: P46092