CHM anticorps

N° du produit ABIN7880414

Cet anticorps Lapin Polyclonal détecte spécifiquement CHM dans WB, IF, FACS et IHC (p). Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour CHM anticorps (ABIN7880414)

Antigène: CHM (Choroideremia (Rab Escort Protein 1) (CHM))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHM est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-CHM anticorps

Fonction: CHM Antibody / Choroideremia protein

Séquence: QDQILENEEA IALSRKDKTI QHVEVFCYAS QDLHED

Purification: Antigen affinity purified

Immunogène: Amino acids QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED from the human protein were used as the immunogen for the CHM antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CHM antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the CHM antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur CHM

Antigène: CHM (Choroideremia (Rab Escort Protein 1) (CHM))

Autre désignation: CHM

Sujet: Rab escort protein 1 (REP1) also known as Rab proteins geranylgeranyltransferase component A 1, and Choroideremia protein, is an enzyme that in humans is encoded by the CHM gene. It is mapped to Xq21.2. This gene encodes component A of the RAB geranylgeranyl transferase holoenzyme. In the dimeric holoenzyme, this subunit binds unprenylated Rab GTPases and then presents them to the catalytic Rab GGTase subunit for the geranylgeranyl transfer reaction. Rab GTPases need to be geranylgeranyled on either one or two cysteine residues in their C-terminus to localize to the correct intracellular membrane. Mutations in this gene are a cause of choroideremia, also known as tapetochoroidal dystrophy (TCD). This X-linked disease is characterized by progressive dystrophy of the choroid, retinal pigment epithelium and retina. Alternatively spliced transcript variants have been found for this gene.

UniProt: P24386

Pathways: Sensory Perception of Sound