CHTOP anticorps

N° du produit ABIN7880415

L’anticorps anti-CHTOP Polyclonal Lapin est utilisé pour la détection de CHTOP dans des échantillons de Humain, Souris, Rat et Singe. Il a été validé pour WB, IHC (p) et FACS.

Aperçu rapide pour CHTOP anticorps (ABIN7880415)

Antigène: CHTOP (Chromatin Target of PRMT1 (CHTOP))

Reactivité: Humain, Souris, Rat, Singe

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHTOP est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Détail du produit anti-CHTOP anticorps

Fonction: CHTOP Antibody / Chromatin target of PRMT1 protein / C1orf77

Séquence: AAQSAPKVVL KSTTKMSLNE RFTNMLKNKQ

Purification: Antigen affinity purified

Immunogène: Amino acids AAQSAPKVVLKSTTKMSLNERFTNMLKNKQ were used as the immunogen for the CHTOP antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CHTOP antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the CHTOP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur CHTOP

Antigène: CHTOP (Chromatin Target of PRMT1 (CHTOP))

Autre désignation: CHTOP

Sujet: This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

UniProt: Q9Y3Y2