Cofilin 2 anticorps

N° du produit ABIN7880465

Cet anticorps Souris Monoclonal détecte spécifiquement Cofilin 2 dans WB, IF, IHC (p), ICC et FACS. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Cofilin 2 anticorps (ABIN7880465)

Antigène: Cofilin 2 (CFL2)

Reactivité: Humain, Souris, Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Cofilin 2 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Flow Cytometry (FACS)

Clone: 8C13

Détail du produit anti-Cofilin 2 anticorps

Fonction: Cofilin 2 Antibody / CFL2

Séquence: KDAIKKKFTG IKHEWQVNGL DDIKDRSTLG EKL

Purification: Affinity purified

Immunogène: Amino acids KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL were used as the immunogen for the Cofilin 2 antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the Cofilin 2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the Cofilin 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur Cofilin 2

Antigène: Cofilin 2 (CFL2)

Autre désignation: Cofilin 2

Sujet: Cofilin 2 (muscle), also known as CFL2, is a protein which in humans is encoded by the CFL2 gene. It is mapped to 14q12. This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. And this protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH -dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.

UniProt: Q9Y281

Pathways: Caspase Cascade in Apoptosis