DHX15 anticorps

N° du produit ABIN7880608

Cet anticorps anti-DHX15 Polyclonal Lapin (ABIN7880608) détecte spécifiquement DHX15 dans WB, IHC (p), IF et FACS. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour DHX15 anticorps (ABIN7880608)

Antigène: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX15 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Flow Cytometry (FACS)

Détail du produit anti-DHX15 anticorps

Fonction: DHX15 Antibody / Prp43

Séquence: DIKPEWLVKI APQYYDMSNF PQCEAKRQLD RIIAKLQSKE YSQY

Purification: Affinity purified

Immunogène: Amino acids DIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY from the human protein were used as the immunogen for the DHX15 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the DHX15 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the DHX15 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur DHX15

Antigène: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Autre désignation: DHX15

Sujet: Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 is an enzyme that in humans is encoded by the DHX15 gene. It is mapped to 4p15.2. The protein encoded by this gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.

UniProt: O43143