TMEM166 anticorps

N° du produit ABIN7880761

Cet anticorps anti-TMEM166 Polyclonal Lapin (ABIN7880761) détecte spécifiquement TMEM166 dans WB, FACS et IHC (p). L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour TMEM166 anticorps (ABIN7880761)

Antigène: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM166 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-TMEM166 anticorps

Fonction: TMEM166 Antibody / EVA1A

Séquence: MRLPLSHSPE HVEMALLSNI LAAYSFVSEN PERA

Purification: Antigen affinity purified

Immunogène: Amino acids MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA from the human protein were used as the immunogen for the TMEM166 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the TMEM166 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the TMEM166 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur TMEM166

Antigène: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Autre désignation: TMEM166

Sujet: Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

UniProt: Q9H8M9