GAD65 anticorps

N° du produit ABIN7880883

L’anticorps anti-GAD65 Monoclonal Souris est utilisé pour la détection de GAD65 dans des échantillons de Humain, Rat et Souris. Il a été validé pour WB, FACS, IHC (p) et IF.

Aperçu rapide pour GAD65 anticorps (ABIN7880883)

Antigène: GAD65 (GAD2) (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kDa) (GAD2))

Reactivité: Humain, Rat, Souris

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp GAD65 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF)

Clone: 7G2

Détail du produit anti-GAD65 anticorps

Fonction: GAD2 Antibody / GAD65

Séquence: KVIDFHYPNE LLQEYNWELA DQPQNLEEIL MHCQ

Purification: Affinity purified

Immunogène: Amino acids KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ from the human protein were used as the immunogen for the GAD2 antibody.

Isotype: IgG2a

Information d'application

Indications d'application: Optimal dilution of the GAD2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the GAD2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur GAD65

Antigène: GAD65 (GAD2) (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kDa) (GAD2))

Autre désignation: GAD2

Sujet: Glutamate decarboxylase 2, also known as GAD65, is an enzyme that in humans is encoded by the GAD2 gene. This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.

UniProt: Q05329