HECTD3 anticorps

N° du produit ABIN7880991

L’anticorps anti-HECTD3 Polyclonal Lapin est utilisé pour la détection de HECTD3 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB, IHC (p) et FACS.

Aperçu rapide pour HECTD3 anticorps (ABIN7880991)

Antigène: HECTD3 (HECT Domain Containing 3 (HECTD3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HECTD3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Détail du produit anti-HECTD3 anticorps

Fonction: HECTD3 Antibody

Séquence: HYASAKVCEE KLRYAAYNCV AIDTDMSPWE E

Purification: Antigen affinity purified

Immunogène: Amino acids HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE from the human protein were used as the immunogen for the HECTD3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HECTD3 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the HECTD3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur HECTD3

Antigène: HECTD3 (HECT Domain Containing 3 (HECTD3))

Autre désignation: HECTD3

Sujet: The protein encoded by this gene transfers ubiquitin from an E2 ubiquitin-conjugating enzyme to targeted substrates, leading to the degradation of those substrates. This gene is mapped to 1p34.1. The encoded protein has been shown to transfer ubiquitin to TRIOBP to facilitate cell cycle progression, and to STX8.

UniProt: Q5T447