LPO anticorps

N° du produit ABIN7881485

Cet anticorps anti-LPO Polyclonal Lapin (ABIN7881485) détecte spécifiquement LPO dans WB et IF. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour LPO anticorps (ABIN7881485)

Antigène: LPO

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB), Immunofluorescence (IF)

Détail du produit

Fonction: LPO Antibody / Lactoperoxidase

Séquence: MFRLDENYQP WGPEPELPLH TLFFNTWRMV KD

Purification: Antigen affinity purified

Immunogène: Amino acids MFRLDENYQPWGPEPELPLHTLFFNTWRMVKD from the human protein were used as the immunogen for the LPO antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the LPO antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the LPO antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détail du antigène

Antigène: LPO

Sujet: Lactoperoxidase is a peroxidase enzyme secreted from mammary, salivary and other mucosal glands including the lungs, bronchii and nose that functions as a natural and the first line of defense against antibacterial and antiviral agents. Lactoperoxidase is a member of the heme peroxidase family of enzymes. In humans, lactoperoxidase is encoded by the LPO gene. This gene encodes a member of the peroxidase family of proteins. The encoded preproprotein is proteolytically processed to generate the mature enzyme. Following its secretion from salivary, mammary, and other mucosal glands, this enzyme catalyzes the generation of the antimicrobial substance hypothiocyanous acid. This gene is present in a gene cluster on chromosome 17. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.

UniProt: P22079