MLX anticorps

N° du produit ABIN7881563

Cet anticorps anti-MLX Polyclonal Lapin (ABIN7881563) détecte spécifiquement MLX dans WB et FACS. L’anticorps est réactif avec des échantillons de Humain, Souris et Singe.

Aperçu rapide pour MLX anticorps (ABIN7881563)

Antigène: MLX (MAX-Like Protein X (MLX))

Reactivité: Humain, Souris, Singe

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MLX est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS)

Détail du produit anti-MLX anticorps

Fonction: MLX Antibody / Max-like protein X

Séquence: FQELSACVFS WIEEHCKPQT LREIVIGVLH QLKNQLY

Purification: Antigen affinity purified

Immunogène: Amino acids FQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY from the human protein were used as the immunogen for the MLX antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MLX antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the MLX antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur MLX

Antigène: MLX (MAX-Like Protein X (MLX))

Autre désignation: MLX

Sujet: Max-like protein X is a protein that in humans is encoded by the MLX gene. The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

UniProt: Q9UH92