MBD1 anticorps

N° du produit ABIN7881627

Cet anticorps Lapin Polyclonal détecte spécifiquement MBD1 dans WB et FACS. Il présente une réactivité avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour MBD1 anticorps (ABIN7881627)

Antigène: MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MBD1 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS)

Détail du produit anti-MBD1 anticorps

Fonction: MBD1 Antibody

Séquence: DLTLFDFKQG ILCYPAPKAH PVAVASKKRK

Purification: Affinity purified

Immunogène: Amino acids DLTLFDFKQGILCYPAPKAHPVAVASKKRK from the human protein were used as the immunogen for the MBD1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MBD1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the MBD1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur MBD1

Antigène: MBD1 (Methyl-CpG Binding Domain Protein 1 (MBD1))

Autre désignation: MBD1

Sujet: MBD1 (Methyl-CpG-Binding Domain Protein 1), also known as PCM1 or CXXC3, is a protein that in humans is encoded by the MBD1 gene. Using PCR on a hybrid panel and FISH, Hendrich et al.(1999) mapped the MBD1 gene to chromosome 18q21, 2.1 cM distal to MBD2. Using yeast 2-hybrid analysis, reciprocal immunoprecipitation analysis, and protein pull-down assays, Fujita et al.(2003) showed that MBD1 interacted directly with MCAF. Deletion analysis revealed that the C-terminal transcriptional repressor domain(TRD) of MBD1 interacted with a conserved C-terminal domain of MCAF. Reporter gene assays showed that MCAF increased the repressive function of the isolated TRD of MBD1 against SP1. Chromatin immunoprecipitation analysis revealed that MBD1 linked MCAF to methylated promoters. Uchimura et al.(2006) found that MBD1 was multiply sumoylated in HeLa cells. Sumoylation did not alter the intracellular localization of MBD1 at nuclear foci in C-33A human cervical cancer cells.

UniProt: Q9UIS9