METTL3 anticorps

N° du produit ABIN7881630

Cet anticorps Lapin Polyclonal détecte spécifiquement METTL3 dans WB, IF, ELISA, FACS et IHC (p). Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour METTL3 anticorps (ABIN7881630)

Antigène: METTL3 (Methyltransferase Like 3 (METTL3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METTL3 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), ELISA, Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-METTL3 anticorps

Fonction: METTL3 Antibody

Séquence: HNVQPNWITL GNQLDGIHLL DPDVVARFKQ RYPDGIISKP KNL

Purification: Affinity purified

Immunogène: Amino acids HNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL from the human protein were used as the immunogen for the METTL3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the METTL3 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the METTL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur METTL3

Antigène: METTL3 (Methyltransferase Like 3 (METTL3))

Autre désignation: METTL3

Sujet: N6-adenosine-methyltransferase 70 kDa subunit (METTL3) is an enzyme that in humans is encoded by the METTL3 gene. It is mapped to 14q11.2. This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.

UniProt: Q86U44