CCDC90A anticorps

N° du produit ABIN7881645

Cet anticorps Lapin Polyclonal détecte spécifiquement CCDC90A dans WB et IHC (p). Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour CCDC90A anticorps (ABIN7881645)

Antigène: CCDC90A (MCUR1) (Mitochondrial Calcium Uniporter Regulator 1 (MCUR1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC90A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-CCDC90A anticorps

Fonction: MCUR1 Antibody / Mitochondrial calcium uniporter regulator 1

Séquence: ATQQAEIIVS ALVKILEANM DIVYKDMVTK MQQE

Purification: Antigen affinity purified

Immunogène: Amino acids ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE from the human protein were used as the immunogen for the MCUR1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MCUR1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the MCUR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur CCDC90A

Antigène: CCDC90A (MCUR1) (Mitochondrial Calcium Uniporter Regulator 1 (MCUR1))

Autre désignation: MCUR1

Sujet: MCUR1 is an inner mitochondrial membrane protein that has been shown to function as a component of the mitochondrial Ca(2+) uniporter, in the assembly of mitochondrial respiratory complex IV, and in mitochondrial permeability transition (MPT). The MCUR1 gene is mapped to chromosome 6p23 based on an alignment of the MCUR1 sequence with the genomic sequence.

UniProt: Q96AQ8