MSI1 anticorps

N° du produit ABIN7881687

Cet anticorps Souris Monoclonal détecte spécifiquement MSI1 dans WB, IF et IHC (p). Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour MSI1 anticorps (ABIN7881687)

Antigène: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Reactivité: Humain, Souris, Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp MSI1 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 2B9

Détail du produit anti-MSI1 anticorps

Fonction: Msi1 Antibody / Musashi 1

Séquence: KMFIGGLSWQ TTQEGLREYF GQFGEVKECL VMRD

Purification: Affinity purified

Immunogène: Amino acids KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD from the human protein were used as the immunogen for the Msi1 antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the Msi1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the Msi1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur MSI1

Antigène: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Autre désignation: Msi1

Sujet: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

UniProt: O43347

Pathways: Stem Cell Maintenance