MYH6 anticorps

N° du produit ABIN7881735

Cet anticorps Lapin Polyclonal détecte spécifiquement MYH6 dans WB, FACS et IHC (p). Il présente une réactivité avec des échantillons de Rat, Humain et Souris.

Aperçu rapide pour MYH6 anticorps (ABIN7881735)

Antigène: MYH6 (Myosin Heavy Chain 6, Cardiac Muscle, alpha (MYH6))

Reactivité: Rat, Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYH6 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-MYH6 anticorps

Fonction: Myosin 6 Antibody / MyHC-alpha / MYH6

Séquence: RTLEDQANEY RVKLEEAQRS LNDFTTQRAK LQ

Purification: Antigen affinity purified

Immunogène: Amino acids RTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQ from the human protein were used as the immunogen for the Myosin 6 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Myosin 6 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the Myosin 6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur MYH6

Antigène: MYH6 (Myosin Heavy Chain 6, Cardiac Muscle, alpha (MYH6))

Autre désignation: Myosin 6

Sujet: Myosin heavy chain, alpha isoform (MHC-alpha) is a protein that in humans is encoded by the MYH6 gene. Cardiac muscle myosin is a hexamer consisting of two heavy chain subunits, two light chain subunits, and two regulatory subunits. This gene encodes the alpha heavy chain subunit of cardiac myosin. The gene is located approximately 4kb downstream of the gene encoding the beta heavy chain subunit of cardiac myosin. Mutations in this gene cause familial hypertrophic cardiomyopathy and atrial septal defect 3.

UniProt: P13533