MYH10 anticorps

N° du produit ABIN7881741

Cet anticorps Lapin Polyclonal détecte spécifiquement MYH10 dans WB, IF, FACS et IHC (p). Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour MYH10 anticorps (ABIN7881741)

Antigène: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYH10 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-MYH10 anticorps

Fonction: MYH10 Antibody / non-muscle Myosin IIB

Séquence: QRTGLEDPER YLFVDRAVIY NPATQADWTA KK

Purification: Affinity purified

Immunogène: Amino acids QRTGLEDPERYLFVDRAVIYNPATQADWTAKK from the human protein were used as the immunogen for the MYH10 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MYH10 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the MYH10 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur MYH10

Antigène: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Autre désignation: MYH10

Sujet: This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin, it should not be confused with the unconventional myosin-10 (MYO10). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: P35580