NFIA anticorps

N° du produit ABIN7881836

Cet anticorps anti-NFIA Monoclonal Souris (Clone 16H11) (ABIN7881836) détecte spécifiquement NFIA dans WB, IF, FACS et IHC (p). L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour NFIA anticorps (ABIN7881836)

Antigène: NFIA (Nuclear Factor I/A (NFIA))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp NFIA est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 16H11

Détail du produit anti-NFIA anticorps

Fonction: NFIA Antibody

Séquence: AYFVHAADSS QSESPSQPSD ADIKDQPENG HLGFQDSFVT SGVFS

Purification: Purified

Immunogène: Amino acids AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS from the human protein were used as the immunogen for the NFIA antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the NFIA antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the NFIA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur NFIA

Antigène: NFIA (Nuclear Factor I/A (NFIA))

Autre désignation: NFIA

Sujet: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiplegenes, differential splicing, and heterodimerization.

UniProt: Q12857